Fairview Park electrical services and violation corrections is something AC Electric specializes in. Give us a call now to see how we can be of service to you;

1.67 Rating by CuteStat

electricalservicesfairviewpark.com is 9 years 2 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, electricalservicesfairviewpark.com is SAFE to browse.

PageSpeed Score
87
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

184.168.221.3

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: 4
H5 Headings: 1 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 12
Google Adsense: Not Applicable Google Analytics: UA-53995212-4

Websites Hosted on Same IP (i.e. 184.168.221.3)

Casa e Mar

- rioapartmentrental.com
Not Applicable $ 8.95

Email Signature Generator - Email Signature Software - Rocketseed

- rocketseed.com

Create a professional email signature using Rocketseed email signature software. Outlook, Exchange & G Suit compatible. Start driving engagement and sales!

361,919 $ 24,840.00

Kingman Daily Miner | Kingman, AZ

- kingmandailyminer.com
Not Applicable $ 8.95

YouTube

- dotallyrad.com

This is an Esports and gaming channel focused on Forts, Dota 2, SC2 Zealot Hockey, Heroes of Newerth. Hello, I'm daggius, the founder of Dotallyrad.com, and ...

Not Applicable $ 8.95

Scripps Ranch | San Diego Unified School District

- srhsfalcons.org
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: Apache/2.2
Vary: Accept-Encoding,Cookie
Cache-Control: max-age=3, must-revalidate
Content-Type: text/html; charset=UTF-8
Content-Encoding: gzip
Date: Tue, 10 Mar 2015 23:50:43 GMT
Expires: Tue, 10 Mar 2015 23:50:46 GMT
Accept-Ranges: bytes
Connection: Keep-Alive
Last-Modified: Tue, 10 Mar 2015 08:09:45 GMT
Content-Length: 7838

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: Mar 3, 2015, 12:00 AM 9 years 2 months 1 week ago
Last Modified: Mar 3, 2015, 12:00 AM 9 years 2 months 1 week ago
Expiration Date: Mar 3, 2016, 12:00 AM 8 years 2 months 1 week ago
Domain Status:
clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns39.domaincontrol.com 97.74.109.20 United States of America United States of America
ns40.domaincontrol.com 173.201.77.20 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
electricalservicesfairviewpark.com A 3586 IP: 184.168.221.3
electricalservicesfairviewpark.com NS 3599 Target: ns40.domaincontrol.com
electricalservicesfairviewpark.com NS 3599 Target: ns39.domaincontrol.com
electricalservicesfairviewpark.com SOA 3599 MNAME: ns39.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2015030301
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 600
electricalservicesfairviewpark.com MX 3599 Priority: 10
Target: mailstore1.secureserver.net
electricalservicesfairviewpark.com MX 3599 Target: smtp.secureserver.net

Full WHOIS Lookup

Domain Name: ELECTRICALSERVICESFAIRVIEWPARK.COM
Registrar URL: http://www.godaddy.com
Registrant Name: Asmint Cruz
Registrant Organization: AC Electric
Name Server: NS39.DOMAINCONTROL.COM
Name Server: NS40.DOMAINCONTROL.COM
DNSSEC: unsigned

For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=ELECTRICALSERVICESFAIRVIEWPARK.COM

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.